GCLC anticorps (N-Term)

N° du produit ABIN631566

Cet anticorps anti-GCLC est un anticorps Lapin Polyclonal détectant GCLC dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour GCLC anticorps (N-Term) (ABIN631566)

Antigène: GCLC (Glutamate-Cysteine Ligase, Catalytic Subunit (GCLC))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GCLC est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-GCLC anticorps

Épitope: N-Term

Specificité: GCLC antibody was raised against the N terminal of GCLC

Purification: Affinity purified

Immunogène: GCLC antibody was raised using the N terminal of GCLC corresponding to a region with amino acids VLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTVEAN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GCLC Blocking Peptide, (ABIN5613739), is also available for use as a blocking control in assays to test for specificity of this GCLC antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCLC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GCLC

Antigène: GCLC (Glutamate-Cysteine Ligase, Catalytic Subunit (GCLC))

Autre désignation: GCLC

Sujet: Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. GCLC is the catalytic subunit of 637 amino acids with a calculated molecular weight of 72.773 kDa. Deficiency of gamma-glutamylcysteine synthetase in human is associated with enzymopathic hemolytic anemia.

Poids moléculaire: 73 kDa (MW of target protein)

Pathways: Cell RedoxHomeostasis